PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03075.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 275aa    MW: 30544.7 Da    PI: 9.3837
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03075.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-161462148
                                    TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                                    +g+W++eEd +l+ +++q G+g +W + ++++g++R++k+c++rw++yl
  Zmw_sc03075.1.g00070.1.am.mkhc 14 KGPWSPEEDTKLKSYIEQNGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                                    79*********************************************97 PP

2Myb_DNA-binding39.11.8e-1269111246
                                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                 Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                     g +++eEd +++ +    G++ W+ Ia+ ++ gRt++++k++w++
  Zmw_sc03075.1.g00070.1.am.mkhc  69 GGFSEEEDRIILSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                                     569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.156962IPR017930Myb domain
SuperFamilySSF466892.04E-2612109IPR009057Homeodomain-like
SMARTSM007179.9E-121364IPR001005SANT/Myb domain
PfamPF002493.3E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-231569IPR009057Homeodomain-like
CDDcd001673.68E-91662No hitNo description
PROSITE profilePS5129422.17463117IPR017930Myb domain
SMARTSM007171.3E-1167115IPR001005SANT/Myb domain
PfamPF002493.2E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2370117IPR009057Homeodomain-like
CDDcd001671.66E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MGRAPCCDKA TVKKGPWSPE EDTKLKSYIE QNGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIRHGG FSEEEDRIIL SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLFGK  120
QSRKDQRQQQ QHFMRQAAAS DGMKQEANGG ASGSSSMAEA AYSWHQQATT VPMQQPTPGI  180
AMDGHRPGDG VDESIRKLLH KLKLGGSPFA SLPQFVPPPL YEGSPSFAPT PCQVEITSLY  240
EAGVQCSNGL PSLEQDQNLN FNQVKLDGLD FFFGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25141177108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981607.11e-145PREDICTED: myb-related protein Myb4-like
TrEMBLK4ACS41e-145K4ACS4_SETIT; Uncharacterized protein
STRINGSi036681m1e-144(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412